Mailu logo

Mailu

Fully featured Docker‑based mail server that's simple to deploy

Mailu delivers a complete email solution—IMAP, SMTP, webmail, anti‑spam, TLS, DKIM, and admin UI—all packaged as Docker images for quick setup and easy maintenance.

Mailu banner

Overview

Overview

Mailu is a self‑hosted email platform designed for teams and organizations that want full control over their communications without relying on proprietary services. It bundles all essential mail components—IMAP/IMAP+, SMTP, submission, webmail, and an administration console—into a cohesive Docker‑compose stack.

Capabilities

The solution supports standard protocols with auto‑configuration profiles, advanced features such as aliases, domain delegation, full‑text attachment search, and managesieve filtering. Security is baked in: enforced TLS, DANE, MTA‑STS, automatic Let’s Encrypt certificates, outgoing DKIM signing, and integrated anti‑virus scanning. Anti‑spam measures include greylisting, SPF/DKIM/DMARC validation, auto‑learned filters and attachment blocking.

Deployment

Deploying Mailu requires only Docker and Docker‑compose. A single configuration file defines the mail services, database, and optional components, allowing rapid spin‑up on any host or cloud instance. Updates are handled by pulling newer images, and the entire stack remains fully open source under the MIT license.

Highlights

Standard email protocols with auto‑configuration (IMAP, IMAP+, SMTP, Submission)
Built‑in anti‑spam and security (DKIM, DMARC, TLS, DANE, LetsEncrypt, virus scanning)
Webmail and admin UI with multi‑domain and quota management
Docker‑compose deployment; all components are FOSS under MIT

Pros

  • Easy Docker‑based installation and updates
  • Comprehensive feature set comparable to commercial solutions
  • Strong security defaults (TLS, DANE, MTA‑STS)
  • Fully open source with no proprietary trackers

Considerations

  • Requires familiarity with Docker and container orchestration
  • Limited official GUI for advanced mail flow debugging
  • Performance depends on host resources and Docker configuration
  • Community support may vary compared to enterprise vendors

Managed products teams compare with

When teams consider Mailu, these hosted platforms usually appear on the same shortlist.

Bird Email API logo

Bird Email API

Email sending API & SMTP relay with analytics and deliverability tooling

Gmail logo

Gmail

Email service with spam protection and Google integration

MailerSend logo

MailerSend

Email API for transactional and bulk email

Looking for a hosted option? These are the services engineering teams benchmark against before choosing open source.

Fit guide

Great for

  • Small to medium businesses needing a self‑hosted mail system
  • Developers who prefer containerized services
  • Organizations prioritizing privacy and open‑source software
  • Teams that want integrated webmail and admin interface

Not ideal when

  • Large enterprises requiring dedicated hardware appliances
  • Users without Docker experience or infrastructure
  • Environments needing extensive commercial support SLAs
  • Deployments that demand proprietary email features not included

How teams use it

Deploy a company mail system in minutes

Launch IMAP/SMTP services with webmail and admin UI using a single docker‑compose file.

Provide secure email for a development team

Enable automatic TLS, DKIM signing, and anti‑spam filters without external services.

Run a multi‑domain mail service for a hosting provider

Manage separate domains, aliases, quotas, and per‑domain delegation from the admin console.

Integrate email fetching from external accounts

Configure fetched accounts and managesieve rules to consolidate external mail into the Mailu server.

Tech snapshot

Python73%
HTML13%
Shell5%
Dockerfile2%
HCL2%
JavaScript2%

Tags

fetchmailpop3webmailsmtpmailserverdkimletsencryptimapmaildmarcemaildockerdocker-compose

Frequently asked questions

What Docker version is required?

Any recent Docker engine that supports docker‑compose (Docker 20.x or newer) works with Mailu.

How are TLS certificates obtained?

Mailu can automatically request and renew Let’s Encrypt certificates when the feature is enabled.

Which webmail clients are included?

The stack ships with multiple webmail options such as Roundcube and Rainloop, selectable via configuration.

How does spam protection work?

Mailu combines greylisting, SPF/DKIM/DMARC checks, auto‑learned filters, and optional antivirus scanning to reduce unwanted mail.

Project at a glance

Active
Stars
7,136
Watchers
7,136
Forks
976
Repo age10 years old
Last commit3 weeks ago
Primary languagePython

Last synced 3 weeks ago