LinkStack logo

LinkStack

Customizable, privacy‑first link hub you can self‑host.

LinkStack lets you create a personalized link page, host it on your own server or use a free community instance, with drag‑and‑drop setup, themes, and an admin panel.

LinkStack banner

Overview

Overview

LinkStack is a self‑hosted platform that replaces single‑link solutions by allowing users to publish a page packed with multiple links. Its drag‑and‑drop installation means you can drop the linkstack folder into any web root without touching the command line, making deployment straightforward for non‑technical users.

Features & Deployment

The built‑in admin panel supports multiple user accounts, theme uploads, and a one‑click updater that backs up the previous version. A dedicated Docker image (Alpine Linux, Apache2, PHP 8.2) provides an alternative “pull‑and‑run” deployment for those comfortable with containers. Community‑hosted instances are also available for anyone who prefers a ready‑made service while still benefiting from the project's privacy‑first stance – no data is sold to third parties.

Who Benefits

Whether you are an influencer, a small business, or a nonprofit, LinkStack gives you full control over branding, data ownership, and link organization without recurring fees.

Highlights

Drag‑and‑drop self‑hosting with no command‑line required
Customizable themes uploaded via the admin panel
Multi‑user admin interface for managing individual link pages
Official Docker image for quick container deployment

Pros

  • Free and privacy‑focused; no data selling
  • Easy installation – just copy files or use Docker
  • Extensible appearance through community‑contributed themes
  • One‑click updater with automatic backups

Considerations

  • Self‑hosting requires a web server or Docker environment
  • Limited built‑in analytics compared to commercial services
  • Backup retains only two previous versions
  • MySQL databases are not included in automatic backups

Managed products teams compare with

When teams consider LinkStack, these hosted platforms usually appear on the same shortlist.

Beacons logo

Beacons

Link in bio & creator hub with store, email, and media kit

Bento logo

Bento

Personal profile and link-in-bio page builder that lets creators design a unified online presence easily

Bio.fm logo

Bio.fm

Link in bio that embeds videos, music, and social posts in rich blocks

Looking for a hosted option? These are the services engineering teams benchmark against before choosing open source.

Fit guide

Great for

  • Individuals who want a personal link hub without third‑party tracking
  • Small businesses needing a branded page for multiple marketing links
  • Nonprofits or community groups that prefer self‑hosted solutions
  • Developers who want to customize appearance via CSS themes

Not ideal when

  • Users without any hosting capability or Docker knowledge
  • Organizations that require advanced analytics dashboards
  • Enterprises needing dedicated support contracts
  • Sites that rely on complex server‑side integrations beyond PHP

How teams use it

Personal brand aggregation

A creator consolidates social media, portfolio, and merch links on a single, customizable page.

Small business marketing hub

A local shop displays product pages, reservation links, and contact forms under its own domain.

Community organization member pages

Each member gets a personal link page managed through a shared admin panel.

Event promotion with themed design

An event team deploys a themed LinkStack instance to share schedule, tickets, and sponsor links.

Tech snapshot

PHP65%
Blade35%

Tags

open-sourceself-hostedpersonal-websitewebapplinktree-alternativehacktoberfestlaravelphplinktreeprivacybladelinkstack

Frequently asked questions

How do I install LinkStack?

Download the latest release, place the `linkstack` folder in your web root, and follow the on‑screen setup wizard.

Can I use LinkStack without self‑hosting?

Yes, community‑hosted instances are available for free registration.

How are themes added?

Upload a theme ZIP file via the Admin Panel’s Themes tab; the new theme appears in the selector.

Is my data sold to third parties?

No. LinkStack is built with a privacy‑first philosophy and does not sell user data.

How do I update an existing installation?

Click the update notification in the Admin Panel for a one‑click upgrade, or pull the latest Docker image.

Project at a glance

Active
Stars
3,520
Watchers
3,520
Forks
387
LicenseAGPL-3.0
Repo age4 years old
Last commit2 months ago
Self-hostingSupported
Primary languagePHP

Last synced 2 weeks ago